PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG493500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family bZIP
Protein Properties Length: 410aa    MW: 44027 Da    PI: 7.4539
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG493500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.48.3e-10243301563
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          kr +r   NR +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+  +a l +++
  Pavir.9NG493500.1.p 243 KRVKRVLANRQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSAGLATQN 301
                          999*********************************************99998887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-16239303IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.691241304IPR004827Basic-leucine zipper domain
PfamPF001703.8E-9243301IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-10243294No hitNo description
Gene3DG3DSA:1.20.5.1701.8E-10243300No hitNo description
CDDcd147032.42E-22244295No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MNTANGNGLA HHHHVQAPPM PPPPAHQKQR PGLPPTPPPS APGSHSLHHA GACVDDSSAA  60
QAQAQGGLPP RRAHRRSCSD VAFGYFQPLP PPSPTPKVES GGWGLPGGAA GDDLFNAYMS  120
MEGMDGLNNN SDGDSRGSSG MRTNGADSSE NESEDYGGGG QFLLWGDAGK KKRNAAGEPA  180
PPPPARHARS LSMDSLMGKL SFSANGEPGR FSLEFGGGEF TPAEMKRIMA DEKLAEMALA  240
DPKRVKRVLA NRQSAARSKE RRMRYIAELE QKVQILQTEA TTLSAQLTLL QRDSAGLATQ  300
NNELKFRLQA MEQQAQLRDA LNEALSTEVQ RLKLGATSSS GGMPQQMQQL RCQNQMVELH  360
KQQGEQIPFY QLEHREQNGA PRNHDPKGRN EDGSEGHAST CAELYGKNV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0352290.0BT035229.1 Zea mays full-length cDNA clone ZM_BFb0046N14 mRNA, complete cds.
GenBankJX4699260.0JX469926.1 Zea mays subsp. mays clone UT3184 bZIP-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698006.10.0PREDICTED: transcription factor RF2b-like
TrEMBLK4AKY80.0K4AKY8_SETIT; Uncharacterized protein
STRINGSi039566m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.34e-55bZIP family protein